missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human LRP12 (aa 564-696) Control Fragment Recombinant Protein

Código de producto. 30206518
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30206518 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30206518

Marca: Invitrogen™ RP90323

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53568 (PA5-53568. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Members of the LDL receptor gene family, including LDLR (low density lipoprotein receptor), LRP1 (low density lipoprotein related protein), Megalin (also designated GP330), VLDLR (very low density lipoprotein receptor) and ApoER2 are characterized by a cluster of cysteine-rich class A repeats, epidermal growth factor (EGF)-like repeats, YWTD repeats and an O-linked sugar domain. LRP12, also designated ST7, is a member of the LDLR family that is thought to be involved in the internalization of lipophilic molecules and/or signal transduction. LRP12 has been shown to interact with RACK1, MADHIP and Integrin beta-1-binding protein 3. It is widely expressed in heart, skeletal muscle, brain, lung, placenta and pancreas. Overexpression of LRP12 may be associated with oral tumors, therefore implicating LRP12 as a potential oncogene.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9Y561
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 29967
Nombre Human LRP12 (aa 564-696) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AI848829; C820005L12Rik; LDL receptor related protein 12; LDLR-related protein 12; low density lipoprotein receptor-related protein 12; low density lipoprotein-related protein 12; low-density lipoprotein receptor-related protein 12; LRP12; LRP-12; ST7; Suppressor of tumorigenicity 7 protein
Nombre común LRP12
Símbolo de gen LRP12
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia FPVCSPNQASVLENLRLAVRSQLGFTSVRLPMAGRSSNIWNRIFNFARSRHSGSLALVSADGDEVVPSQSTSREPERNHTHRSLFSVESDDTDTENERRDMAGASGGVAAPLPQKVPPTTAVEATVGACASSS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.