Learn More
Invitrogen™ Human LPP (aa 48-179) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP90640
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53590 (PA5-53590. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of a subfamily of LIM domain proteins that are characterized by an N-terminal proline rich region and three C-terminal LIM domains. The encoded protein localizes to the cell periphery in focal adhesions and may be involved in cell-cell adhesion and cell motility. This protein also shuttles through the nucleus and may function as a transcriptional co-activator. This gene is located at the junction of certain disease related chromosomal translocations which result in the expression of chimeric proteins that may promote tumor growth. Alternate splicing results in multiple transcript variants.
Especificaciones
Q93052 | |
Blocking Assay, Control | |
4026 | |
100 μL | |
9430020K16Rik; AA959454; AU024130; B130055L10Rik; C79715; D630048H16; I79_000864; LIM domain containing preferred translocation partner in lipoma; LIM domain-containing preferred translocation partner in lipoma; LIM protein; lipoma preferred partner; Lipoma-preferred partner; Lipoma-preferred partner homolog; Lipoma-preferred-partner; LPP | |
LPP | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human LPP (aa 48-179) Control Fragment | |
RUO | |
LPP | |
Unconjugated | |
Recombinant | |
VVAPKPKYNPYKQPGGEGDFLPPPPPPLDDSSALPSISGNFPPPPPLDEEAFKVQGNPGGKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVSTPVTGHKRMVIPNQPPLTATKKST | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.