missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30209850

Invitrogen™ Human LHFPL5 (aa 51-91) Control Fragment Recombinant Protein

Código de producto. 30209850
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30209850 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30209850

Marca: Invitrogen™ RP109978

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144747 (PA5-144747. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in this gene result in deafness in humans, and a mutation in a similar gene in mice results in deafness and vestibular dysfunction with severe degeneration of the organ of Corti. It is proposed to function in hair bundle morphogenesis.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q8TAF8
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 222662
Nombre Human LHFPL5 (aa 51-91) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 9330179O15Rik; DFNB67; dJ510O8.8; hscy; LHFPL tetraspan subfamily member 5 protein; Lhfpl5; LHFP-like protein 5; lipoma HMGIC fusion partner-like 5; lipoma HMGIC fusion partner-like 5 protein; Tetraspan membrane protein of hair cell stereocilia; tetraspan transmembrane protein, hair cell stereocilia; TMHS
Nombre común LHFPL5
Símbolo de gen LHFPL5
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia GDSVNTPQAGYFGLFSYCVGNVLSSELICKGGPLDFSSIPS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.