missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30209469

Invitrogen™ Human LFG (aa 1-45) Control Fragment Recombinant Protein

Código de producto. 30209469
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30209469

Marca: Invitrogen™ RP92046

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82634 (PA5-82634. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LFG, a seven transmembrane spanning protein, is a recently identified member of a family whose members can inhibit apoptotic cell death induced by Fas receptor. LFG is a human homolog of rat NMP35 and consists of a conserved transmembrane domain and a small cytoplasmic domain. Reports have shown that LFG protects the cell from Fas-mediated neuronal cell death in a novel way. LFG binds to Fas receptor but doesn't have any effect in reducing Fas expression or decreasing the ability of FADD binding to the receptor. Furthermore, LFG doesn't protect the cells from TNF-alpha mediated cell death process. Although LFG is ubiquitously expressed, Northern blot analysis detected an increased expression in hippocampus and other neural tissues, suggesting a protective role in neurodegenerative diseases.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9BWQ8
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 23017
Nombre Human LFG (aa 1-45) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2900002L20Rik; FAIM2; Fas apoptotic inhibitory molecule 2; fas apoptotic inhibitory molecule 2; protein lifeguard 2; Kiaa0950; Lfg; LFG2; lifeguard; neural membrane protein 35; NGP35; NMP25; Nmp35; protein lifeguard; protein lifeguard 2; TMBIM2; transmembrane BAX inhibitor motif-containing protein 2
Nombre común LFG
Símbolo de gen FAIM2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGE
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado