missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30212982

Invitrogen™ Human KIRREL2 (aa 228-285) Control Fragment Recombinant Protein

Código de producto. 30212982
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30212982

Marca: Invitrogen™ RP108630

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84950 (PA5-84950. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a type I transmembrane protein and member of the immunoglobulin superfamily of cell adhesion molecules. The encoded protein localizes to adherens junctions in pancreatic beta cells and regulates insulin secretion. Autoantibodies against the encoded protein have been detected in serum from patients with type 1 diabetes. This gene may also play a role in glomerular development and decreased expression of this gene has been observed in human glomerular diseases. This gene and the related opposite-strand gene nephrin are regulated by a bidirectional promoter.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q6UWL6
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 84063
Nombre Human KIRREL2 (aa 228-285) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen C330019F22Rik; DKFZp564A1164; FILTRIN; kin of IRRE like 2; kin of IRRE like 2 (Drosophila); kin of irregular chiasm-like 2; kin of irregular chiasm-like protein 2; kin of IRRE-like 2; kin of IRRE-like protein 2; kin of IRRE-like protein 2; LOW QUALITY PROTEIN: kin of IRRE-like protein 2; kirre like nephrin family adhesion molecule 2; KIRREL2; MGC15718; NEPH3; nephrin-like 3; nephrin-like gene 1; nephrin-like protein 3; NLG1; UNQ5827/PRO19646; x kin of IRRE like 2
Nombre común KIRREL2
Símbolo de gen KIRREL2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia EVTLSASPHTVQEGEKVIFLCQATAQPPVTGYRWAKGGSPVLGARGPRLEVVADASFL
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado