missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human JunD (aa 107-146) Control Fragment Recombinant Protein

Código de producto. 30211225
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30211225 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30211225

Marca: Invitrogen™ RP103487

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

JunD is a transcription factor which is coded by JunD gene. JunD transcriptional activity is modulated by phosphorylation in response to cellular stress via the c-Jun N terminal kinase (JNK)/Stress-Activated Protein Kinase (SAPK) family of protein kinase. Jun proteins are capable of forming dimers with Fos, ATF and CREB family transcription factors to form the AP-1 complex that differentially regulates a variety of target genes involved in cellular growth, proliferation, differentiation and apoptosis. Also, JunD plays an important role in metabolism via modulation of IGF-1 signaling pathway.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P17535
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 3727
Nombre Human JunD (aa 107-146) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen activator protein 1; AP1; AP-1; JUN D; jun D proto-oncogene; Jun proto-oncogene related gene d; Jun proto-oncogene related gene d1; Jund; Jun-d; JunD proto-oncogene, AP-1 transcription factor subunit; Jund1; JunD-FL isoform; Oncogene Jun-D; Transcription factor jun-D
Nombre común JunD
Símbolo de gen JUND
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia IIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALED
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.