missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ITGA2 (aa 1032-1126) Control Fragment Recombinant Protein

Código de producto. 30204134
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30204134 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30204134

Marca: Invitrogen™ RP103386

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD49b (Integrin alpha 2, Integrin alpha 2 chain, VLA-2 alpha chain, HM alpha 2) is a member of the integrin family. It is a glycoprotein with molecular weight of 150 kD, and it complexes with CD29 (Integrin beta 1) to form the heterodimeric integrin VLA-2 (integrin alpha 2 beta 1, or GPIa/IIa) complex. VLA-2 is an extracellular receptor for laminin, collagen, and fibronectin, and interaction with its ligands results in the activation of intracellular signaling pathways. It has reported roles in VEGF-induced angiogenesis in vivo, as well as adhesion and lymphocyte activation. CD49b is expressed by NK cells, NK-T cells, monocytes, platelets, and epithelial cells. It is also expressed on adaptive immune cells such as T and B cells, specifically on a subset of CD4+ T cells in the spleen, on intraepithelial and lamina propria lymphocytes in the intestine, as well as on a population of peripheral CD4+ type 1 T regulatory (Tr1) cells that co-express LAG-3.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P17301
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 3673
Nombre Human ITGA2 (aa 1032-1126) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen alpha 2 subunit of VLA-2 receptor; BDPLT9; BR; CD49 antigen-like family member B; CD49B; Collagen receptor; D x 5; GPIa; HPA-5; human platelet alloantigen system 5; integrin alpha 2; integrin alpha-2; integrin subunit alpha 2; integrin, alpha 2; integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor); Itga2; platelet antigen Br; platelet glycoprotein GPIa; platelet membrane glycoprotein Ia; very late activation protein 2 receptor, alpha-2 subunit; VLA-2; VLA2 receptor; VLA-2 receptor, alpha 2 subunit; VLA-2 subunit alpha; VLAA2
Nombre común CD49b (Integrin alpha 2)
Símbolo de gen Itga2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SSSVSFKSENFRHTKELNCRTASCSNVTCWLKDVHMKGEYFVNVTTRIWNGTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDE
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.