missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30208625

Invitrogen™ Human IRF2 (aa 87-188) Control Fragment Recombinant Protein

Código de producto. 30208625
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30208625

Marca: Invitrogen™ RP102258

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83159 (PA5-83159. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IRF2 belongs to the interferon regulatory factor family. IRF2 regulates the transcription regulation important to cell proliferation as well as immune responses by binding to the upstream regulatory region of type I IFN and IFNinducible MHC class I genes (the interferon consensus sequence (ICS)) and repression of those genes. However, IRF2 also functions as a transcriptional activator of histone H4 by interactions with NF-kappa B.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P14316
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 3660
Nombre Human IRF2 (aa 87-188) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 9830146E22Rik; AI646973; DKFZp686F0244; Interferon regulatory factor 2; IRF2; Irf-2; OTTHUMP00000218576; OTTHUMP00000218580
Nombre común IRF2
Símbolo de gen IRF2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIE
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado