missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human IP3 Receptor 1 (aa 2472-2553) Control Fragment Recombinant Protein

Código de producto. 30201680
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30201680 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30201680

Marca: Invitrogen™ RP91255

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Intracellular channel that mediates calcium release from the endoplasmic reticulum following stimulation by inositol 1,4,5-trisphosphate. Involved in the regulation of epithelial secretion of electrolytes and fluid through the interaction with AHCYL1. Plays a role in ER stress-induced apoptosis. Cytoplasmic calcium released from the ER triggers apoptosis by the activation of CaM kinase II, eventually leading to the activation of downstream apoptosis pathways.
TRUSTED_SUSTAINABILITY

Specifications

Número de acceso Q14643
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 3708
Nombre Human IP3 Receptor 1 (aa 2472-2553) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen ACV; CLA4; D6Pas2; ENSMUSG00000072853; Gm10429; I145TR; inositol 1,4,5-triphosphate receptor 1; inositol 1,4,5-triphosphate receptor, type 1; inositol 1,4,5-trisphosphate receptor 1; inositol 1,4,5-trisphosphate receptor type 1; inositol 1,4,5-trisphosphate receptor, type 1; inositol 1,4,5-trisphosphate-binding protein P400; Insp3r; InsP3R type I; insP3R1; IP3 receptor; IP3 receptor isoform 1; Ip3r; IP-3-R; IP3R 1; IP3R1; Itpr1; Itpr-1; opisthotonus; opt; P400; Pcd6; Pcp1; Pcp-1; PPP1R94; protein PCD-6; protein phosphatase 1, regulatory subunit 94; Purkinje cell protein 1; SCA15; SCA16; SCA29; SI-SIII-SIIA; Type 1 inositol 1,4,5-trisphosphate receptor; type 1 InsP3 receptor
Nombre común IP3 Receptor 1
Símbolo de gen Itpr1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia KDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.