Learn More
Invitrogen™ Human INT7 (aa 464-554) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP108599
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84902 (PA5-84902. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a subunit of the integrator complex. The integrator complex associates with the C-terminal domain of RNA polymerase II and mediates 3'-end processing of the small nuclear RNAs U1 and U2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Especificaciones
Q9NVH2 | |
Blocking Assay, Control | |
25896 | |
100 μL | |
5930412E23Rik; C1orf73; DKFZP434B168; Int7; Integrator complex subunit 7; Ints7; RGD1308014 | |
INTS7 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human INT7 (aa 464-554) Control Fragment | |
RUO | |
INT7 | |
Unconjugated | |
Recombinant | |
GDGMLGDLMELYKVIGRSATDKQQELLVSLATVIFVASQKALSVESKAVIKQQLESVSNGWTVYRIARQASRMGNHDMAKELYQSLLTQVA | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Sugerencias de productos
Customers who viewed this item also viewed.
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.