missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Importin 8 (aa 917-1037) Control Fragment Recombinant Protein

Código de producto. 30205888
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30205888 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30205888 Proveedor Invitrogen™ N.º de proveedor RP91847

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54881 (PA5-54881. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Importin 8 is a 1037 amino acid nuclear protein with a RAN binding site. It belongs to RAN-binding protein super family and hence shares an N-terminal sequence motif with importin-beta that appears to account for RAN GTP binding. It binds to the nuclear pore complex (NPC) and is well known as a transport carrier that mediates nuclear import of ribosomal proteins with a classical nuclear localization signal. Importin 8 works by binding to the nuclear pore complex and, along with RANGTP and RANBP1, inhibits the GAP stimulation of the RAN GTPase. Along with transportin it also helps in the nuclear import of SRP19.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso O15397
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 10526
Nombre Human Importin 8 (aa 917-1037) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 6230418K12Rik; Abcc10; ATP-binding cassette, sub-family C (CFTR/MRP), member 10; C130009K11Rik; FLJ26580; imp8; importin 8; importin-8; IPO8; MRP7; Om1; OM-1; oocyte maturation 1; RAN binding protein 8; ran-binding protein 8; RANBP8
Nombre común Importin 8
Símbolo de gen IPO8
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SNNGRGEDEEEEDDDWDEEVLEETALEGFSTPLDLDNSVDEYQFFTQALITVQSRDAAWYQLLMAPLSEDQRTALQEVYTLAEHRRTVAEAKKKIEQQGGFTFENKGVLSAFNFGTVPSNN
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.