Learn More
Invitrogen™ Human IL11RA (aa 143-233) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP110226
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144769 (PA5-144769. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Interleukin 11 is a stromal cell-derived cytokine that belongs to a family of pleiotropic and redundant cytokines that use the gp130 transducing subunit in their high affinity receptors. This gene encodes the IL-11 receptor, which is a member of the hematopoietic cytokine receptor family. This particular receptor is very similar to ciliary neurotrophic factor, since both contain an extracellular region with a 2-domain structure composed of an immunoglobulin-like domain and a cytokine receptor-like domain. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jun 2012].
Especificaciones
Q14626 | |
Blocking Assay, Control | |
3590 | |
100 μL | |
AI314697; CRSDA; Enhancer trap locus homolog 2; Etl2; etl-2; GP130; IL-11 receptor subunit alpha; IL-11 receptor subunit alpha-1; IL-11 R subunit alpha; IL-11 R subunit alpha-1; Il11ra; IL-11 RA; Il11ra1; IL-11 RA1; Il11ra2; Il-11 ra-alpha; IL-11 R-alpha; IL-11 R-alpha-1; interleukin 11 receptor subunit alpha; interleukin 11 receptor, alpha; interleukin 11 receptor, alpha chain 1; interleukin 11 receptor, alpha chain 2; interleukin-11 receptor alpha chain; interleukin-11 receptor subunit alpha; Interleukin-11 receptor subunit alpha-1; locus 2; novel cytokine receptor 1; NR1; NR-1; sIL11RA | |
IL11RA | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human IL11RA (aa 143-233) Control Fragment | |
RUO | |
IL11RA | |
Unconjugated | |
Recombinant | |
RYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYP | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.