missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30206058

Invitrogen™ Human IL11RA (aa 143-233) Control Fragment Recombinant Protein

Código de producto. 30206058
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30206058

Marca: Invitrogen™ RP110226

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144769 (PA5-144769. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Interleukin 11 is a stromal cell-derived cytokine that belongs to a family of pleiotropic and redundant cytokines that use the gp130 transducing subunit in their high affinity receptors. This gene encodes the IL-11 receptor, which is a member of the hematopoietic cytokine receptor family. This particular receptor is very similar to ciliary neurotrophic factor, since both contain an extracellular region with a 2-domain structure composed of an immunoglobulin-like domain and a cytokine receptor-like domain. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jun 2012].
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q14626
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 3590
Nombre Human IL11RA (aa 143-233) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AI314697; CRSDA; Enhancer trap locus homolog 2; Etl2; etl-2; GP130; IL-11 receptor subunit alpha; IL-11 receptor subunit alpha-1; IL-11 R subunit alpha; IL-11 R subunit alpha-1; Il11ra; IL-11 RA; Il11ra1; IL-11 RA1; Il11ra2; Il-11 ra-alpha; IL-11 R-alpha; IL-11 R-alpha-1; interleukin 11 receptor subunit alpha; interleukin 11 receptor, alpha; interleukin 11 receptor, alpha chain 1; interleukin 11 receptor, alpha chain 2; interleukin-11 receptor alpha chain; interleukin-11 receptor subunit alpha; Interleukin-11 receptor subunit alpha-1; locus 2; novel cytokine receptor 1; NR1; NR-1; sIL11RA
Nombre común IL11RA
Símbolo de gen IL11RA
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia RYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYP
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado