missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human IKK epsilon (aa 573-708) Control Fragment Recombinant Protein

Código de producto. 30198641
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30198641 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30198641

Marca: Invitrogen™ RP91453

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IKBKE is an activator of nuclear factor-kappa-B. Over expression of IKBKE has been observed in breast cancer cells, and suppression of IKBKE induces cell death. NF-kappa-B is a ubiquitous transcription factor and an essential mediator of gene expression during activation of immune and inflammatory responses. NF-kappa-B mediates the expression of a great variety of genes in response to extracellular stimuli. NF-kappa-B is associated with Ikappa-B proteins in the cell cytoplasm, which inhibit NF-kappa-B activity. Ikappa-B is phosphorylated by Ikappa-B kinase (IKK) complex that contains IKK-a, IKK-b, and IKK-gamma. A novel molecule in the IKK complex was recently identified and designated IKK-iota/IKK-i. IKK epsilon is required for the activation of NF-kappa-B by PMA and T cell receptors but not by TNF-a and IL-1. IKK-iota/IKK-i message is expressed in a variety of tissues and is inducible by TNF-a, IL-1, and LPS.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q14164
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 9641
Nombre Human IKK epsilon (aa 573-708) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AW558201; I-kappa-B kinase epsilon; Ikbke; IKKE; IKK-E; IKKepsilon; IKK-epsilon; IKKI; IKK-i; IKK-related kinase epsilon; inducible I kappa-B kinase; inducible IkappaB kinase; inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon; inhibitor of kappaB kinase epsilon; inhibitor of nuclear factor kappa-B kinase subunit epsilon; KIAA0151; RP11-534L20.1
Nombre común IKK epsilon
Símbolo de gen IKBKE
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia IHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKGAQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLN
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.