missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HOXC12 (aa 6-79) Control Fragment Recombinant Protein

Código de producto. 30182568
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30182568

Marca: Invitrogen™ RP97593

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63152 (PA5-63152. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Homeobox (Hox) proteins are a family of transcription factors that play a role in development and cellular differentiation by regulating downstream target genes. Specifically, the Hox proteins direct DNA-protein and protein-protein interactions that assist in determining the morphologic features associated with the anterior-posterior body axis. Hox proteins are involved in controlling axial patterning, leukemias and hereditary malformations. In mammals, there are four gene clusters encoding Hox proteins, namely HoxA, HoxB, HoxC and HoxD, that are located on different chromosomes, each consisting of 9-11 tandemly arranged genes. HoxC12 (Homeobox C12), also known as Hox3, Hox3F or HOC3F, is a member of the Abd-B homeobox (Hox) family and is encoded by a gene from the HoxC cluster. HoxC12 is a 282 amino acid long nuclear protein that contains one homeobox DNA-binding domain.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P31275
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 3228
Nombre Human HOXC12 (aa 6-79) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen HOC3F; homeo box C12; homeobox C12; homeobox protein Hox-3.8; Homeobox protein Hox-3 F; Homeobox protein Hox-C12; Homeobox protein Hox-C12 (Hox-3 F); HO x 3; Hox-3.8; HO x 3 F; HOXC12; Hoxc-12
Nombre común HOXC12
Símbolo de gen HOXC12
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLSWPSAEPCNGYPQPYLGSPVSLNPPF
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado