missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30199866

Invitrogen™ Human HM13 (aa 130-209) Control Fragment Recombinant Protein

Código de producto. 30199866
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30199866

Marca: Invitrogen™ RP91119

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60919 (PA5-60919. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein, resulting in the release of the fragment from the ER membrane into the cytoplasm. Required to generate lymphocyte cell surface (HLA-E) epitopes derived from MHC class I signal peptides. May play a role in graft rejection. May be necessary for the removal of the signal peptide that remains attached to the hepatitis C virus core protein after the initial proteolytic processing of the polyprotein. Involved in the intramembrane cleavage of the integral membrane protein PSEN1. Cleaves the integral membrane protein XBP1 isoform 1 in a DERL1/RNF139- dependent manner.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q8TCT9
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 81502
Nombre Human HM13 (aa 130-209) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1200006O09Rik; 4930443L17Rik; 5031424B04Rik; AV020344; cb228; H13; H-13; hIMP1; histocompatibility (minor) 13; histocompatibility 13; histocompatibility minor 13; HM13; hm13 protein; IMP1; IMP-1; IMPAS; IMPAS-1; intramembrane aspartyl protease; intramembrane protease 1; minor histocompatibility antigen 13; minor histocompatibility antigen H13; MSTP086; presenilin-like aspartyl protease; presenilin-like protein 3; PSENL3; PSL3; Signal peptide peptidase; signal peptide peptidase beta; signal peptide peptidase like 1; SPP; SPPL1; Unknown (protein for MGC:134054); wu:fc11a06; zgc:56660; zgc:86862
Nombre común HM13
Símbolo de gen HM13
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia PASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGC
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado