missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HLA-DPB1 Control Fragment Recombinant Protein

Código de producto. 30209235
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30209235 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30209235 Proveedor Invitrogen™ N.º de proveedor RP90436

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82411 (PA5-82411. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HLA-DPB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules. HLA and MHC antibodies play a significant role in Immunopeptidomics, facilitating the identification and characterization of neoantigens through high-performance liquid chromatography coupled to tandem Mass Spectrometry.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P04440
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 3115
Nombre Human HLA-DPB1 Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen beta1 domain MHC class II HLA DPB; CD; CELIAC1; class II HLA beta chain; DC-1 alpha chain; DC-alpha; DPB1; DQ-A1; GSE; histocompatibility antigen HLA-DR alpha; HLA class II histocompatibility antigen, DP beta 1 chain; HLA class II histocompatibility antigen, DP(W4) beta chain; HLA class II histocompatibility antigen, DQ alpha 1 chain; HLA class II histocompatibility antigen, DQ(W3) alpha chain; HLA class II histocompatibility antigen, DR alpha chain; HLA DP14-beta chain; HLA-DCA; HLA-DP; HLA-DP histocompatibility type, beta-1 subunit; HLA-DP1B; HLA-DPB; HLA-DPB1; HLA-DQA; HLA-DQA1; HLA-DRA; HLA-DRA1; leucocyte antigen DQA1; leukocyte antigen alpha chain; major histocompatibility complex class II antigen beta chain; major histocompatibility complex, class II, DP beta 1; major histocompatibility complex, class II, DQ alpha 1; major histocompatibility complex, class II, DR alpha; MHC cell surface glycoprotein; MHC cla; MHC class II antigen; MHC class II antigen beta chain; MHC class II antigen DP beta 1 chain; MHC class II antigen DPB1; MHC class II antigen DPbeta1; MHC class II antigen DRA; MHC class II DQA1; MHC class II HLA-D alpha glycoprotein; MHC class II HLA-DP-beta-1; MHC class II HLA-DQ-alpha-1; MHC class II HLA-DRB1; MHC class II surface glycoprotein; MHC HLA DPB1; MHC HLA-DQ alpha; MLRW
Nombre común HLA-DPB1
Símbolo de gen HLA-DPB1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia YNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTF
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.