Learn More
Invitrogen™ Human HLA-DPA1 (aa 48-184) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP90437
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53682 (PA5-53682. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
HLA-DPA1 belongs to the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules. HLA and MHC antibodies play a significant role in Immunopeptidomics, facilitating the identification and characterization of neoantigens through high-performance liquid chromatography coupled to tandem Mass Spectrometry.
Especificaciones
P20036 | |
Blocking Assay, Control | |
3113 | |
100 μL | |
DP(W3); DP(W4); HLA class II histocompatibility antigen, DP alpha 1 chain; HLADP; HLA-DP1A; HLA-DPA1; HLASB; HLA-SB alpha chain; major histocompatibility complex, class II, DP alpha 1; MHC class II antigen; MHC class II DP3-alpha; MHC class II DPA1; MHC class II HLA-DPA1 antigen; PLT1; Primed lymphocyte test-1 | |
HLA-DPA1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human HLA-DPA1 (aa 48-184) Control Fragment | |
RUO | |
HLA-DPA1 | |
Unconjugated | |
Recombinant | |
RPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTF | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.