missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HLA-DOA (aa 25-74) Control Fragment Recombinant Protein

Código de producto. 30198670
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30198670 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30198670 Proveedor Invitrogen™ N.º de proveedor RP109842

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Reacts with HLA-DO, a heterodimer formed by DNalpha and DObeta subunits in B cells. DNalpha and DObeta are the products of the non-classical class II genes, HLA-DNA and HLA-DOB, respectively. DO forms tight complexes with DM in the endoplasmic reticulum and is thereby sorted to lysosomal vesicles during antigen processing and presentation. It is tightly associated with DM and it is selectively expressed on antigen-presenting cells, such as B cells, dendritic cells and thymic epithelial cells. DO can enhance the efficiency of peptide loading and has been found to stabilize DM at low pH, preserving its chaperon activity. DO-DM complexes are more efficient than DM in protecting empty DR molecules. Reports describe DO as a co-chaperone of DM. HLA and MHC antibodies play a significant role in Immunopeptidomics, facilitating the identification and characterization of neoantigens through high-performance liquid chromatography coupled to tandem Mass Spectrometry.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P06340
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 3111
Nombre Human HLA-DOA (aa 25-74) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen HLA class II histocompatibility antigen, DO alpha chain; HLA-D0-alpha; HLA-DNA; HLA-DOA; HLADZ; HLA-DZA; lymphocyte antigen; major histocompatibility complex, class II, DN alpha; major histocompatibility complex, class II, DO alpha; MHC class II antigen DOA; MHC DN-alpha; MHC DZ alpha
Nombre común HLA-DOA
Símbolo de gen HLA-DOA
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.