Invitrogen™ Human Hemicentin 2 (aa 4332-4408) Control Fragment Recombinant Protein

Recombinant Protein

Marca: Invitrogen™ RP107759

Código de producto. 30202874

271.00€ / 100 microlitros

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67115 (PA5-67115. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Hemicentin 2 is a protein coding gene.

Especificaciones

Número de acceso	Q8NDA2
Para utilizar con (aplicación)	Blocking Assay, Control
ID de gen (Entrez)	256158
Cantidad	100 μL
Alias de gen	hemicentin 2; hemicentin-2; HMCN2; LOW QUALITY PROTEIN: hemicentin-2
Símbolo de gen	HMCN2
Especie	Human
Etiqueta de proteína	His-ABP-tag
Contenido y almacenamiento	-20°C, Avoid Freeze/Thaw Cycles
Formulario	Liquid

Concentración	≥5.0 mg/mL
Formulación	1 M urea, PBS with no preservative; pH 7.4
Nombre	Human Hemicentin 2 (aa 4332-4408) Control Fragment
Estado normativo	RUO
Nombre común	Hemicentin 2
Conjugado	Unconjugated
Recombinante	Recombinant
Secuencia	PTIEWLQAGQPLRASRRLRTLPDGSLWLENVETGDAGTYDCVAHNLLGSATARAFLVVRGEPQGSWGSMTGVINGRK
Sistema de expresión	E. coli
Grado de pureza o calidad	>80% by SDS-PAGE and Coomassie blue staining

Sugerencias de productos

Customers who viewed this item also viewed. This information does not imply a recommendation or representation of any kind and any action taken upon the information provided is strictly at your own risk. The products shown have not been qualified by Fisher Scientific for any particular purpose, application or use and it is the responsibility of the purchaser to ensure that the performance of the product is suitable for the purchasers specific use or intended application.

Viewing 1-4 of

Catalog No. 10678484

Thermo Scientific ™ Pierce ™ BCA Protein Assa Thermo Scientific ™ Pierce ™ BCA Protein Assa

211,00 € / 500 ml
Catalog No. 13464189

Thermo Scientific ™ Mezcla de proteasas tripsi Thermo Scientific ™ Mezcla de proteasas tripsi

108,00 € / paquete de 5
Catalog No. 10647894

Thermo Scientific ™ Solución de sustrato para Thermo Scientific ™ Solución de sustrato para

288,00 € / 250 ml
Catalog No. 11560626

Gibco ™ Tripsina-EDTA (0,25%), rojo de fenol Gibco ™ Tripsina-EDTA (0,25%), rojo de fenol

21,47 € / 100 ml
Catalog No. 11580626

Gibco ™ Tripsina-EDTA (0,05 %), rojo fenol Gibco ™ Tripsina-EDTA (0,05 %), rojo fenol

16,60 € / 100 ml
Catalog No. 11548876

Gibco ™ Penicilina-estreptomicina (10.000 U/ml Gibco ™ Penicilina-estreptomicina (10.000 U/ml

20,92 € / 100 ml
Catalog No. 10729174

Invitrogen ™ Goat anti-Rabbit IgG (H+L) Cross- Invitrogen ™ Goat anti-Rabbit IgG (H+L) Cross-

320,00 € / 500 microlitros
Catalog No. 11514270

Invitrogen Trenbolone Polyclonal Antibody, Invi Invitrogen Trenbolone Polyclonal Antibody, Invi

880,00 € / 100 microlitros
Catalog No. 17821163

Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech

233,00 € / 100 microgramos
Catalog No. 17833373

Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech

90,00 € / 100 microgramos
Catalog No. 17831293

Gibco ™ Human IL-2 Recombinant Protein, PeproTech Gibco ™ Human IL-2 Recombinant Protein, PeproTech

210,00 € / 50 microgramos

Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Invitrogen™ Human Hemicentin 2 (aa 4332-4408) Control Fragment Recombinant Protein > 100 μL; Unlabeled

Su nombre

Dirección de correo electrónico *

Tipo de problema *

Descripción detallada del problema/solicitud *

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Cancelar Enviar

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado

¿Detecta una oportunidad de mejora?Comparta una corrección de contenido

Invitrogen™ Human Hemicentin 2 (aa 4332-4408) Control Fragment Recombinant Protein

Descripción

Especificaciones

Sugerencias de productos

Documentos

Promociones