missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30197400

Invitrogen™ Human HAP40 (aa 279-371) Control Fragment Recombinant Protein

Código de producto. 30197400
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30197400

Marca: Invitrogen™ RP104413

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61382 (PA5-61382. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Huntington's disease is caused by an expanded CAG trinucleotide repeat coding for a polyglutamine stretch within the Huntington protein. Huntington co-purifies with a single novel 40 kDa protein designated HAP40. Recombinant HAP40 is cytoplasmic in the presence of Huntington but is actively targeted to the nucleus in the absence of Huntington. These observations suggest that HAP40°Contributes to the function of normal Huntington and is a candidate for involvement in the aberrant nuclear localization of mutant Huntington found in degenerating neurons in Huntington's disease.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P23610
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 474383, 474384, 8263
Nombre Human HAP40 (aa 279-371) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 40-kDa huntingtin-associated protein; AI852759; coagulation factor VIII-associated (intronic transcript) 1; coagulation factor VIII-associated 1; cpG island protein; DXS522E; DXUcsf1; F8A; F8A1; F8A2; F8A3; factor 8-associated gene A; Factor VIII associated protein; factor VIII intron 22 protein; HAP40; huntingtin-associated protein 40; RP23-114O19.4
Nombre común HAP40
Símbolo de gen F8a1, F8a2, F8a3
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LLQPPPAKLLPEHAQTLEKYSWEAFDSHGQESSGQLPEELFLLLQSLVMATHEKDTEAIKSLQVEMWPLLTAEQNHLLHLVLQETISPSGQGV
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado