missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HAAO (aa 199-279) Control Fragment Recombinant Protein

Código de producto. 30199976
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30199976 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30199976

Marca: Invitrogen™ RP104132

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59826 (PA5-59826. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HAAO (3-Hydroxyanthranilate 3, 4-dioxygenase) is a monomeric cytosolic protein of the family of intramolecular dioxygenases containing non-heme ferrous iron. It is widely distributed in peripheral organs, such as liver and kidney, and is present in low amounts in the central nervous system. This enzyme participates in tryptophan metabolism. It employs one cofactor, iron. HAAO catalyzes the synthesis of quinolinic acid (QUIN) from 3-hydroxyanthranilic acid. QUIN is an excitotoxin whose toxicity is mediated by its ability to activate glutamate N-methyl-D-aspartate receptors. Increased cerebral levels of QUIN may participate in the pathogenesis of neurological and inflammatory disorders. HAAO has been suggested to play a role in disorders associated with altered tissue levels of QUIN. Furthermore, recent study shows that HAAO are excellent candidate biomarkers for detecting ovarian cancer.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P46952
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 23498
Nombre Human HAAO (aa 199-279) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 0610007K21Rik; 0610012J07Rik; 3 HAO; 3-HAO; 3-HAO {ECO:0000255; 3-HAOxase; 3-hydroxyanthranilate 3,4-dioxygenase; 3-hydroxyanthranilate 3,4-dioxygenase {ECO:0000255; 3-hydroxyanthranilate oxygenase; 3-hydroxyanthranilate oxygenase {ECO:0000255; 3-hydroxyanthranilic acid dioxygenase; 3-hydroxyanthranilic acid dioxygenase {ECO:0000255; Haao; HAD; HAD {ECO:0000255; HAMAP-Rule:MF_03019}; HAO
Nombre común HAAO
Símbolo de gen HAAO
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia PLSLFGDTYETQVIAYGQGSSEGLRQNVDVWLWQLEGSSVVTMGGRRLSLAPDDSLLVLAGTSYAWERTQGSVALSVTQDP
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.