missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30203387

Invitrogen™ Human GZF1 (aa 109-200) Control Fragment Recombinant Protein

Código de producto. 30203387
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30203387 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30203387 Proveedor Invitrogen™ N.º de proveedor RP93594

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55099 (PA5-55099. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The GDNF-inducible zinc finger protein 1 (GZF1) is a sequence-specific transcriptional repressor with a BTB/POZ domain and ten zinc finger motifs whose expression is required for renal branching morphogenesis during kidney development. GZF1 binds to the 5'regulatory region of the homeodomain protein HOXA10, suggesting that GZF1 may play a role in morphogenesis other than kidney development. Recent experiments have indicated that GZF1 associates with nucleolin and this association is mediated by the first four zinc finger motifs of GZF1. It is thought that Nucleolin modulates the subcellular localization of GZF1 as well as its transcriptional repressor activity.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9H116
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 64412
Nombre Human GZF1 (aa 109-200) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen GDNF inducible zinc finger protein 1; GDNF-inducible zinc finger protein 1; GZF1; ZBTB23; Zinc finger and BTB domain-containing protein 23; zinc finger protein 336; ZNF336
Nombre común GZF1
Símbolo de gen GZF1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia MLEVAEKLKCLDLSETCFQLKKQMLESVLLELQNFSESQEVEVSSGSQVSAAPAPRASVATDGPHPSGLTDSLDYPGERASNGMSSDLPPKK
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.