missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30201065

Invitrogen™ Human GRB2 (aa 160-217) Control Fragment Recombinant Protein

Código de producto. 30201065
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30201065 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30201065

Marca: Invitrogen™ RP104616

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111003 (PA5-111003. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GRB 2 protein contains one SH2 domain flanked on both sides by an SH3 domain. In response to EGF, GRB 2 binds, through its SH3 domains, to the guanine nucleotide exchange factor, Sos. The GRB 2-Sos complex then binds the EGF receptor. These interactions play a critical role in the activation of the p21 ras signaling pathway.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P62993
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 2885
Nombre Human GRB2 (aa 160-217) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AA408164; abundant SRC homology; adapter protein GRB2; Adapter protein GRB2-A; ASH; ASH protein; EGFRBP-GRB2; epidermal growth factor receptor-binding protein GRB2; grb2; grb2.L; grb2-a; grb2-b; Grb3-3; growth factor receptor bound protein 2; growth factor receptor bound protein 2 L homeolog; growth factor receptor-bound protein 2; Growth factor receptor-bound protein 2-A; growth factor receptor-bound protein 3; HT027; hypothetical protein LOC535298; MST084; MSTP084; NCKAP2; OTTHUMP00000166097; OTTHUMP00000166098; protein Ash; SH2/SH3 adapter GRB2; SH2/SH3 adapter GRB2-A; SH2/SH3 adaptor Grb2; XELAEV_18044055mg
Nombre común GRB2
Símbolo de gen GRB2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia YVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.