missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30196621

Invitrogen™ Human GRASP (aa 51-108) Control Fragment Recombinant Protein

Código de producto. 30196621
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30196621 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30196621

Marca: Invitrogen™ RP107123

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66448 (PA5-66448. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GRASP (General receptor for phosphoinositides 1-associated scaffold protein) plays a role in intracellular trafficking and contributes to the macromolecular organization of group 1 metabotropic glutamate receptors (mGluRs) at synapses, linking receptors to neuronal proteins.This protein contains conserved domains, including a leucine zipper sequence, PDZ domain and a C-terminal PDZ-binding motif.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q7Z6J2
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 160622
Nombre Human GRASP (aa 51-108) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 95 kDa postsynaptic density protein discs-large ZO-1 domain-containing protein; general receptor for phosphoinositides 1 associated scaffold protein; general receptor for phosphoinositides 1-associated scaffold protein; grasp; GRASP-1; graspl; GRIP1; GRIP-1; GRIPAP1; GRP1 (general receptor for phosphoinositides 1)-associated scaffold protein; GRP1 (general receptor for phosphoinositides 1)-associated scaffold protein like; Grp1 (general receptor for phosphoinositides)-associated scaffold protein; GRP1-associated scaffold protein; hypothetical protein LOC558950; KIAA1167; LOW QUALITY PROTEIN: general receptor for phosphoinositides 1-associated scaffold protein; MNCb-4428; protein TAMALIN; PSD-95 PDZ domain-containing protein; Tamalin; trafficking regulator and scaffold protein tamalin; zgc:136876
Nombre común GRASP
Símbolo de gen GRASP
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia PADELYAALEDYHPAELYRALAVSGGTLPRRKGSGFRWKNLSQSPEQQRKVLTLEKED
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.