missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GPT (aa 322-385) Control Fragment Recombinant Protein

Código de producto. 30202024
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30202024 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30202024

Marca: Invitrogen™ RP93885

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83179 (PA5-83179. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GPT(Glutamate-pyruvate transaminase), also known as alanine aminotransferase, catalyzes the reversible conversion of L-alanine and alpha-ketoglutarate to L-glutamate and pyruvate. This protein has 2 distinct molecular and genetic forms: one cytoplasmic (soluble) (GPT1) and one mitochondrial (GPT2). See ALTQTL1 and ALTQTL2 for information on quantitative trait loci influencing the plasma level of alanine aminotransferase.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P24298
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 2875
Nombre Human GPT (aa 322-385) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1300007J06Rik; 2310022B03Rik; AAT1; alanine aminotransferase; alanine aminotransferase 1; ALT; ALT1; glutamate pyruvate transaminase 1; glutamic pyruvate transaminase; glutamic pyruvic transaminase (alanine aminotrasferase); glutamic pyruvic transaminase 1, soluble; glutamic pyruvic transaminase, soluble; glutamic-alanine transaminase 1; glutamic--alanine transaminase 1; glutamic-pyruvate transaminase (alanine aminotransferase); glutamic--pyruvic transaminase; glutamic--pyruvic transaminase 1; GPT; GPT 1; Gpt1; Gpt-1
Nombre común GPT
Símbolo de gen GPT
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia FRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAE
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.