missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GPI (aa 323-412) Control Fragment Recombinant Protein

Código de producto. 30198969
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30198969

Marca: Invitrogen™ RP91942

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82874 (PA5-82874. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene belongs to the GPI family whose members encode multifunctional phosphoglucose isomerase proteins involved in energy pathways. The protein encoded by this gene is a dimeric enzyme that catalyzes the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. The protein functions in different capacities inside and outside the cell. In the cytoplasm, the gene product is involved in glycolysis and gluconeogenesis, while outside the cell it functions as a neurotrophic factor for spinal and sensory neurons. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P06744
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 2821
Nombre Human GPI (aa 323-412) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen Amf; Autocrine motility factor; glucose phosphate isomerase; glucose phosphate isomerase 1; glucose phosphate isomerase 1 complex; glucose phosphate isomerase 1, regulatory; glucose phosphate isomerase 1, structural; glucose phosphate isomerase 1, temporal; glucose-6-phosphate isomerase; glucose-6-phosphate isomerase {ECO:0000250; GNPI; Gpi; GPI {ECO:0000250; gpi {ECO:0000312; GPI1; Gpi-1; Gpi-1 r; Gpi1-r; Gpi1s; Gpi-1 s; Gpi1-s; Gpi-1 t; Gpi1-t; GPI-GlcNAc transferase complex subunit GPI1; hexose monophosphate isomerase; hexosephosphate isomerase; maturation factor; MF; Neuroleukin; neuroleukin {ECO:0000250; NK; NK/GPI; Nlk; NLK {ECO:0000250; Org; oxoisomerase; PGI; PGI {ECO:0000250; Phi; PHI {ECO:0000250; phosphatidylinositol N-acetylglucosaminyltransferase; Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI1; Phosphoglucose isomerase; phosphoglucose isomerase {ECO:0000250; phosphohexomutase; phosphohexose isomerase; phosphohexose isomerase {ECO:0000250; phosphosaccharomutase; RGD:2727}; SA36; SA-36; sperm antigen; sperm antigen 36; sperm antigen-36; UniProtKB:P06745}; YGR216C
Nombre común GPI
Símbolo de gen GPI
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQT
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado