missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30212756

Invitrogen™ Human Glutaminase (aa 617-668) Control Fragment Recombinant Protein

Código de producto. 30212756
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30212756 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30212756

Marca: Invitrogen™ RP96018

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83315 (PA5-83315. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glutaminase is a phosphate-activated amidohydrolase that catalyzes the hydrolysis of glutamine to glutamate and ammonia. It is primarily expressed in the brain and kidney and plays an essential role in generating energy for metabolism, synthesizing neurotransmitter glutamate, and maintaing acid-based balance in the kidney. There are alternate splicing results in multiple transcript variants in the Glutaminase gene.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso O94925
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 2744
Nombre Human Glutaminase (aa 617-668) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 6330442B14; AAD20; AI314027; B230365M23Rik; DKFZp686O15119; FLJ10358; GA; GAC; GAM; GLS; GLS1; Glut; glutaminase; glutaminase C; glutaminase kidney isoform, mitochondrial; Glutaminase kidney isoform, mitochondrial 65 kDa chain; Glutaminase kidney isoform, mitochondrial 68 kDa chain; glutaminase, phosphate-activated; KGA; K-glutaminase; KIAA0838; L-glutamine amidohydrolase; PAG; phosphate-activated glutaminase; RATGLUT
Nombre común Glutaminase
Símbolo de gen GLS
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia DRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGL
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.