missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GGCX (aa 535-647) Control Fragment Recombinant Protein

Código de producto. 30196574
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30196574 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30196574

Marca: Invitrogen™ RP91226

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53770 (PA5-53770. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GGCX (gamma-glutamyl carboxylase), also known as GC or VKCFD1 (Vitamin K-dependent gamma-carboxylase), is a 758 amino acid multi-pass membrane protein. Localized to the membrane of the endoplasmic reticulum, GGCX functions to mediate the vitamin K-dependent carboxylation of glutamate residues on target proteins, thereby producing calcium binding gamma-carboxyglutamate (Gla) residues on these proteins and simultaneously converting vitamin K to vitamin K epoxide. GGCX exists as a monomer and, via its ability to modify glutamate residues, it accomplishes the post-translational changes that are necessary for the activity of all vitamin K-dependent proteins (such as blood coagulation and bone matrix proteins). Defects in the gene encoding GGCX are the cause of combined deficiency of vitamin K-dependent clotting factors 1 (VKCFD1) and PXE-like disorder with multiple coagulation factor deficiency, both of which are characterized by abnormal skin, blood or bone function.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P38435
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 2677
Nombre Human GGCX (aa 535-647) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen FLJ26629; Gamma-glutamyl carboxylase; GC; GGCX; Peptidyl-glutamate 4-carboxylase; vitamin K gamma glutamyl carboxylase; Vitamin K-dependent gamma-carboxylase; VKCFD1
Nombre común GGCX
Símbolo de gen Ggcx
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia FPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVK
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.