missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GATM (aa 24-157) Control Fragment Recombinant Protein

Código de producto. 30199090
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30199090 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30199090

Marca: Invitrogen™ RP88601

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55286 (PA5-55286. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AGAT, also known as glycine amidinotransferase (L-arginine:glycine amidinotransferase), GATM or transamidinase, is a 423 amino acid protein belonging to the amidinotransferase family. Encoded by a gene that maps to human chromosome 15q21.1, AGAT exists as three alternatively spliced isoforms and consists of a homodimer, with equilibrium between monomeric and dimeric forms favoring a monomer subunit structure. AGAT localizes to mitochondrial inner membranes, peripheral membranes and cytoplasm. Biallelically expressed in placenta and fetal tissues, AGAT is also expressed in brain, heart, liver, lung, salivary gland and skeletal muscle tissue, with high expression in kidney. AGAT is elevated in the myocardium during heart failure and is decreased in inter-uterine growth restriction (IUGR)-associated placenta. AGAT catalyzes biosynthesis of guanidinoacetate, the immediate precursor of creatine, which plays a vital role in energy metabolism in muscle tissues. AGAT defects are associated with arginine:glycine amidinotransferase deficiency, an autosomal recessive disorder characterized by developmental delay or regression, mental retardation, severe disturbance of expressive and cognitive speech and severe depletion of creatine/phosphocreatine in brain. AGAT may be linked to embryonic and central nervous system development and may function in heart failure response by elevating local creatine synthesis.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P50440
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 2628
Nombre Human GATM (aa 24-157) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1810003P21Rik; Agat; AI314789; AT; CCDS3; GATM; glycine amidinotransferase; glycine amidinotransferase (L-arginine:glycine amidinotransferase); glycine amidinotransferase, mitochondrial; L-arginine: glycine amidinotransferase; l-arginine:glycine amidinotransferase; testicular secretory protein Li 19; transamidinase
Nombre común GATM
Símbolo de gen GATM
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LGRTLTGWVQRTFQSTQAATASSRNSCAADDKATEPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPD
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.