missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30200396

Invitrogen™ Human GAS6 (aa 503-633) Control Fragment Recombinant Protein

Código de producto. 30200396
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30200396

Marca: Invitrogen™ RP102272

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52539. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene product is a gamma-carboxyglutamic acid (Gla)-containing protein thought to be involved in the stimulation of cell proliferation, and may play a role in thrombosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q14393
Concentración 8.50 mg/mL
Para utilizar con (aplicación) Neutralization, Control
Formulación PBS, 1M urea with no preservative; pH 7.4
ID de gen (Entrez) 2621
Nombre Human GAS6 (aa 503-633) Control Fragment
Intervalo de pH 7.4
Método de purificación Purified
Cantidad 100 μL
Requisitos de almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Estado normativo RUO
Alias de gen AXL receptor tyrosine kinase ligand; AXL stimulatory factor; AXLLG; AXSF; GAS 6; GAS6; GAS-6; GPF; growth arrest specific 6; growth arrest-specific 6; growth arrest-specific protein 6; growth-potentiating factor
Nombre común GAS6
Símbolo de gen GAS6
Tipo de producto Protein
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia STWEVEVVAHIRPAADTGVLFALWAPDLRAVPLSVALVDYHSTKKLKKQLVVLAVEHTALALMEIKVCDGQEHVVTVSLRDGEATLEVDGTRGQSEVSAAQLQERLAVLERHLRSPVLTFAGGLPDVPVTS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado