missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FOXO4 (aa 309-400) Control Fragment Recombinant Protein

Código de producto. 30208404
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30208404 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30208404

Marca: Invitrogen™ RP104704

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FOXO4 (Forkhead box O4) is encoded by the FOXO4 gene located on the X chromosome. It is also known as AFX1 or MLLT7 (Myeloid/Lymphoid or Mixed-Lineage Leukemia (Trithorax Homolog, Translocated To, 7) and is a member of the O class of forkhead/ winged helix family of transcription factors along with FOXO1, FOXO3 and FOXO6. FOXO4 is abundantly expressed in skeletal muscle and adipose tissue. FOXO4 binds to the Insulin Responsive Element (IRE) and activates downstream targets of Insulin/IGF1 signaling such as IGFBP1. However, the activation of another downstream target of the Insulin/IGF1 pathway, Akt, leads to phosphorylation of FOXO4 on specific Ser/Thr residues. This phosphorylation mediates binding of FOXO4 to 14-3-3 and eventual exit of FOXO4 from the nucleus.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P98177
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 4303
Nombre Human FOXO4 (aa 309-400) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AFX; Af x 1; Afxh; AFXzeta; Fkhr3; Fork head domain transcription factor AF x 1; forkhead box O4; forkhead box protein O4; forkhead protein; FOXO4; FOXO4b; MGC120490; MLLT7; myeloid/lymphoid or mixed lineage-leukemia translocation to 7 homolog; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 7; OTTHUMP00000023497; RGD1561201
Nombre común FOXO4
Símbolo de gen FOXO4
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia GLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAEGPLSAGEGCFSSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.