missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FOXA1 (aa 333-399) Control Fragment Recombinant Protein

Código de producto. 30194081
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30194081 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30194081 Proveedor Invitrogen™ N.º de proveedor RP103075

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84008 (PA5-84008. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P55317
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 3169
Nombre Human FOXA1 (aa 333-399) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen Ci-fkh; fkd7; fkh; fork head domain; forkhead box A1; forkhead box protein A1; forkhead-7; Foxa1; FoxA4a; hepatocyte nuclear factor 3 alpha (winged helix transcription factor); hepatocyte nuclear factor 3, alpha; hepatocyte nuclear factor 3-alpha; HNF3A; HNF-3 A; HNF3alpha; HNF-3-alpha; HNF3-alpha; MGC33105; MGC52590; MGC75967; pintallavis; TCF3A; Tcf-3 A; tFoxA1; Transcription factor 3 A; xfkh1; xfkh2
Nombre común FOXA1
Símbolo de gen FOXA1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia QTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHP
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.