missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30212622

Invitrogen™ Human FKBP5 (aa 369-440) Control Fragment Recombinant Protein

Código de producto. 30212622
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30212622 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30212622 Proveedor Invitrogen™ N.º de proveedor RP94651

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FKBP5 is a member of the immunophilin protein family. This family plays a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP5 is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. The gene that encodes FKBP5 has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q13451
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 2289
Nombre Human FKBP5 (aa 369-440) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 51 kDa FK506-binding protein; 51 kDa FKBP; 54 kDa progesterone receptor-associated immunophilin; AIG6; androgen-regulated protein 6; D17Ertd592e; Dit1; EC 5.2.1.8; FF1 antigen; FK506 binding protein 5; FK506-binding protein 5; FKBP prolyl isomerase 5; Fkbp5; FKBP-5; FKBP51; FKBP-51; FKBP54; HSP90-binding immunophilin; p54; peptidylprolyl cis-trans isomerase; Peptidyl-prolyl cis-trans isomerase FKBP5; PPIase; PPIase FKBP5; Ptg-10; rotamase; T-cell FK506-binding protein
Nombre común FKBP5
Símbolo de gen FKBP5
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNE
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.