missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30207269

Invitrogen™ Human Filamin B (aa 1145-1253) Control Fragment Recombinant Protein

Código de producto. 30207269
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30207269 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Code produit. 30207269

Marque: Invitrogen™ RP88633

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52129 (PA5-52129. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FOXK1 is expressed in these cells and regulates cell cycle progression through an interaction with its downstream target the cyclin-dependent kinase inhibitor p21 (CIP). Loss of FOXK1 in mice results in growth retardation and a severe impairment in skeletal muscle regeneration following injury. FOXK1 also shows expression in immature tissues of brain, eye, heart, lung and thymus. It also is predominantly expressed in many malignant tissues, such as tumors of the brain, colon and lymph node.
TRUSTED_SUSTAINABILITY

Spécification

Número de acceso O75369
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 2317
Nombre Human Filamin B (aa 1145-1253) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen ABP-278; ABP-280; ABP-280 homolog; ABP-280-like protein; actin binding protein 278; actin-binding-like protein; AL024016; AOI; beta-filamin; Fh1; filamin B; filamin B, beta; filamin homolog 1; filamin, beta; filamin-3; FilaminB; Filamin-B; FLN1L; FLN3; FLNB; FLN-B; Larsen syndrome 1 (autosomal dominant); LRS1; SCT; TABP; TAP; thyroid autoantigen; Truncated ABP; Truncated actin-binding protein
Nombre común Filamin B
Símbolo de gen FLNB
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia HGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTV
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.