missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30209887

Invitrogen™ Human FES (aa 148-293) Control Fragment Recombinant Protein

Código de producto. 30209887
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30209887 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30209887 Proveedor Invitrogen™ N.º de proveedor RP95943

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51568 (PA5-51568. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FES (FPS) is a tyrosine protein kinase that is required for maintenance of cellular transformation. Its chromosomal location is linked to a specific translocation event identified in patients with acute promyelocytic leukemia, and it is also involved in normal hematopoiesis. Alternative splicing results in multiple variants encoding different isoforms.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P07332
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 2242
Nombre Human FES (aa 148-293) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AI586313; BB137047; c-fes; EC 2.7.10.2; feline sarcoma (Snyder-Theilen) viral (v-fes)/Fujinami avian sarcoma (PRCII) viral (v-fps) oncogene homolog; feline sarcoma oncogene; feline sarcoma/Fujinami avian sarcoma oncogene homolog; Fes; FES proto-oncogene, tyrosine kinase; FPS; Oncogene FES, feline sarcoma virus; p93c-fes; Proto-oncogene c-Fes; proto-oncogene c-Fps; proto-oncogene tyrosine-protein kinase Fes/Fps; RGD1564385; tyrosine kinase Fps/Fes; tyrosine-protein kinase Fes/Fps; Variant 4
Nombre común FES
Símbolo de gen FES
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia DSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEP
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.