missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30181349

Invitrogen™ Human FAM103A1 (aa 1-59) Control Fragment Recombinant Protein

Código de producto. 30181349
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30181349 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30181349 Proveedor Invitrogen™ N.º de proveedor RP98126

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59799 (PA5-59799. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAM103A1, also named as RNMT-activating mini protein, is a 118 amino acid protein, which belongs to the RAM family. FAM103A1 as a component of mRNA cap binding complex localizes in the nucleus. FAM103A1 is required for efficient mRNA cap methylation and regulates RNMT expression by a post-transcriptional stabilizing mechanism.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9BTL3
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 83640
Nombre Human FAM103A1 (aa 1-59) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2410047I02Rik; 2610204K14Rik; C15orf18; Fam103a1; family with sequence similarity 103 member A1; family with sequence similarity 103, member A1; HsT19360; Protein FAM103A1; RAM; Ramac; RAMMET; RGD1310022; RNA guanine-7 methyltransferase activating subunit; RNA guanine-N7 methyltransferase activating subunit; RNMT-activating mini protein; RNMT-activating mRNA cap methylating subunit; RNMT-activating mRNA cap methyltransferase subunit
Nombre común FAM103A1
Símbolo de gen FAM103A1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQ
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.