missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ESX1 Control Fragment Recombinant Protein

Código de producto. 30200139
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30200139

Marca: Invitrogen™ RP100051

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (37%), Rat (37%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62526 (PA5-62526. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Homeobox proteins are transcription factors that contain a helix-turn-helix DNA binding domain termed the homeodomain. ESX1 is an X-linked homeobox gene primarily expressed in the placenta and testis and contains two functional domains: the homeodomain and the proline-rich domain. During embryogenesis, ESX1 is expressed in the extraembryonic tissues, including the endoderm of the visceral yolk sac, the ectoderm of the chorion and the labyrinthine trophoblast of the chorioallantoic placenta. ESX1 can act like a transcriptional repressor to the human oncogene K-ras and treatment of human cancer cells with an ESX1 protein fragment containing the homeodomain reduces the tumorgenicity of cells containing oncogenic K-ras mutations, suggesting ESX1 may be useful as a therapeutic treatment for these cancers.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q8N693
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 80712
Nombre Human ESX1 Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen ESX homeobox 1; ES x 1; ES x 1 L; ES x 1 R; ES x 1-related protein; ESXR1; extraembryonic spermatogenesis homeobox 1; extraembryonic, spermatogenesis, homeobox 1; extraembryonic, spermatogenesis, homeobox 1 homolog; homeobox protein ES x 1; Homeobox protein ES x 1-C; Homeobox protein ES x 1-N; RP3-513M9.1; Sp x 1
Nombre común ESX1
Símbolo de gen Esx1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia HEPEQQQEEPPLLELKQEQEEPPQTTVEGPQPAEGPQTAEGPQPPERKRRRRTAFTQFQ
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado