missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ESRP1 (aa 23-102) Control Fragment Recombinant Protein

Código de producto. 30194453
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30194453

Marca: Invitrogen™ RP105415

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84744 (PA5-84744. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RBM35A, also known as ESRP1, is a mRNA splicing factor that with its related protein RBM35B (ESRP2) are coordinators of an epithelial cell-type-specific splicing program. RBM35A contains three putative RNA recognition motifs and acts by directly binding specific sequences in mRNAs. RBM35A is involved in posttranscriptional regulation of a number of genes such as FGFR2, CD44, CTNND1, and ENAH by exerting a differential effect on protein translation via 5' UTRs of mRNAs. Other recent studies have shown that RMB35A may also act as a novel tumor suppressor.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q6NXG1
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 54845
Nombre Human ESRP1 (aa 23-102) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2210008M09Rik; A630065D16; BC031468; epithelial splicing regulatory protein 1; Esrp1; Rbm35a; RGD1560481; RMB35A; RNA binding motif protein 35 A; RNA-binding motif protein 35 A; RNA-binding protein 35 A
Nombre común ESRP1
Símbolo de gen ESRP1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LGSDEKELILLFWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKIDVESLSSASQLDQALRQFNQSVSNELNIGVGT
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt