missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human EphB2 (aa 269-332) Control Fragment Recombinant Protein

Código de producto. 30202933
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30202933

Marca: Invitrogen™ RP105524

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EPHB2 is a receptor tyrosine kinase that belongs to the ephrin receptor family. Members of the Eph family of kinases play important roles in diverse biological processes including nervous system development, angiogenesis and neural synapsis formation and maturation. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. EphB4 binds to ephrin-B2 and plays an essential role in vascular development.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P29323
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 2048
Nombre Human EphB2 (aa 269-332) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen CAPB; cEK5; chicken embryo kinase 5; chicken embryo kinase 5 protein; developmentally-regulated Eph-related tyrosine kinase; DRT; EFL6; EFNB3; EK5; ELK; ELK-related tyrosine kinase; embryo kinase 5 protein CEK5; EPH B2; EPH receptor B2; eph tyrosine kinase 3; EPHB2; EphB2/CTF1; EphB2/CTF2; EPHB3; EPH-like kinase 5; Ephrin B1; Ephrin B2; Ephrin B3; Ephrin B4; Ephrin type-B receptor 2; EphrinB1; EphrinB2; EphrinB3; EphrinB4; EPHT3; EPLG8; EPTH3; ERK; ETECK; ETK2; HEK2; Hek5; HEK-6; LERK8; MGC87492; NET; Neural kinase; Nuk; Nuk receptor tyrosine kinase; PCBC; Prkm5; protein-tyrosine kinase HEK5; Qek5; Renal carcinoma antigen NY-REN-47; RGD1564232; Sek3; TYRO5; TYRO6; Tyrosine-protein kinase receptor EPH-3; tyrosine-protein kinase receptor SEK-3; Tyrosine-protein kinase TYRO5
Nombre común EphB2
Símbolo de gen EPHB2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia CRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIPSAPQAVI
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado