missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30181092

Invitrogen™ Human ELSPBP1 Control Fragment Recombinant Protein

Código de producto. 30181092
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30181092 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30181092

Marca: Invitrogen™ RP99166

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (36%), Rat (36%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60661 (PA5-60661. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ELSPBP1 (epididymal sperm-binding protein 1), also known as epididymal secretory protein 12 (E12), HE12 or EDDM12, is a 223 amino acid member of the seminal plasma protein family. ELSPBP1 is a secreted protein that is detected in cauda epididymal fluid and on sperm membrane. ELSPBP1 has phosphorylcholine-binding activity and has been shown to bind to spermatozoa upon ejaculation and is thought to play a role in sperm capacitation. N-glycosylated, ELSPBP1 contains four fibronectin type-II domains. The gene that encodes ELSPBP1 maps to human chromosome 19, which consists of over 63 million bases, houses approximately 1,400 genes and is recognized for having the greatest gene density of the human chromosomes.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q96BH3
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 64100
Nombre Human ELSPBP1 Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen E12; EDDM12; EL149; ELSPBP1; epididymal protein 12; epididymal secretory protein 12; epididymal sperm binding protein 1; epididymal sperm-binding protein 1; epididymis luminal secretory protein 149; ESPB1; hE12
Nombre común ELSPBP1
Símbolo de gen ELSPBP1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SCISQGSFLGSLWWSVTSVFDEKQQWKFCETNEYGGNSLRKPCIFPSIYRNNVVSDCMEDESNKLWCPT
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.