Learn More
Abnova™ Human EBI3 Recombinant Protein
Descripción
This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells. [provided by RefSeq]
Especificaciones
Especificaciones
| Número de acceso | Q14213 |
| Para utilizar con (aplicación) | SDS-PAGE |
| Formulación | Lyophilized |
| ID de gen (Entrez) | 10148 |
| Peso molecular | 23.3kDa |
| Nombre | EBI3 (Human) Recombinant Protein |
| Método de preparación | Escherichia coli expression system |
| Pruebas de control de calidad | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Cantidad | 20 μg |
| Inmunógeno | MRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK |
| Mostrar más |
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.