missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30196431

Invitrogen™ Human DYNC2H1 (aa 4163-4257) Control Fragment Recombinant Protein

Código de producto. 30196431
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30196431 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30196431

Marca: Invitrogen™ RP102862

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58626 (PA5-58626. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q8NCM8
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 79659
Nombre Human DYNC2H1 (aa 4163-4257) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 4432416O06Rik; AI448217; ATD3; b2b414Clo; Cytoplasmic dynein 2 heavy chain; Cytoplasmic dynein 2 heavy chain 1; cytoplasmic dynein heavy chain 2; D030010H02Rik; D330044F14Rik; DHC1b; DHC2; Dlp4; Dnch2; Dnchc2; DYH1B; Dync2h1; dynein cytoplasmic 2 heavy chain 1; dynein cytoplasmic heavy chain 2; Dynein heavy chain 11; dynein heavy chain 2; dynein heavy chain isotype 1 B; dynein heavy chain, isotype 1 B; dynein, cytoplasmic 2, heavy chain 1; dynein, cytoplasmic, heavy chain 2; dynein, cytoplasmic, heavy polypeptide 2; dynein-like protein 4; hDHC11; KIAA1997; mDHC11; mKIAA1997; SRPS2B; SRTD3
Nombre común DYNC2H1
Símbolo de gen DYNC2H1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LLSETLDLSELFHPDTFLNALRQETARAVGRSVDSLKFVASWKGRLQEAKLQIKISGLLLEGCSFDGNQLSENQLDSPSVSSVLPCFMGWIPQDA
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.