missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DOCK3 (aa 167-260) Control Fragment Recombinant Protein

Código de producto. 30212090
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30212090

Marca: Invitrogen™ RP96295

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57996 (PA5-57996. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dedicator of cytokinesis3 (DOCK3), also named as MOCA and PBP, is a ∽180 kDa protein involved in signaling transduction. It is a potential guanine nucleotide exchange factor (GEF) which activate some small GTPases by exchanging bound GDP for free GTP. DOCK3 is associated in Alzheimer disease tangles and regulates the accumulation of amyloid precursor protein and beta-amyloid. Overexpression of Dock3 in neural cells promotes axonal outgrowth downstream of brain-derived neurotrophic factor (BDNF) signaling. DOCK3 binds to and inactivates glycogen synthase kinase-3beta (GSK-3beta) at the plasma membrane, thereby promoting axon branching and microtubule assembly. By stimulating actin polymerization and microtubule assembly, DOCK3 plays important roles downstream of BDNF signaling in the CNS.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q8IZD9
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 1795
Nombre Human DOCK3 (aa 167-260) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen dedicator of cytokinesis 3; dedicator of cyto-kinesis 3; dedicator of cytokinesis protein 3; DOCK3; dok-3; KIAA0299; mKIAA0299; MOCA; Modifier of cell adhesion; PBP; Presenilin-binding protein
Nombre común DOCK3
Símbolo de gen Dock3
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia FEVVDSDQISVSDLYKMHLSSRQSVQQSTSQVDTMRPRHGETCRMPVPHHFFLSLKSFTYNTIGEDTDVFFSLYDMREGKQISERFLVRLNKNG
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado