missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30197728

Invitrogen™ Human DNAJC9 (aa 156-245) Control Fragment Recombinant Protein

Código de producto. 30197728
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30197728

Marke: Invitrogen™ RP95737

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57199 (PA5-57199. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DjC9 (DnaJ subfamily C member 9) belongs to the Hsp40 (heat shock protein 40) family of proteins that function as co-chaperones to Hsp70.Hsp40 proteins are classified into 3 main subfamilies (A, B, and C). The families are defined by the presence of particular domains which include a highly conserved alpha-helical N-terminal domain termed the J-domain, a glycine/phenylalanine-rich region, a cysteine-rich region, and a C-terminal beta-sheet containing domain. DjC9 is part of subfamily C that bears only the J-domain. DjC9 has been shown to interact with HSP70 through its J domain and activate its ATPase activity.
TRUSTED_SUSTAINABILITY

Spezifikation

Número de acceso Q8WXX5
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 23234
Nombre Human DNAJC9 (aa 156-245) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 5330419I01Rik; AU020082; DnaJ (Hsp40) homolog, subfamily C, member 9; DnaJ heat shock protein family (Hsp40) member C9; dnaJ homolog subfamily C member 9; DnaJ protein SB73; Dnajc9; DnaJ-like factor; HDJC9; JDD1; SB73
Nombre común DNAJC9
Símbolo de gen DNAJC9
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia EPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt