missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DNAJB4 (aa 274-337) Control Fragment Recombinant Protein

Código de producto. 30196355
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30196355

Marca: Invitrogen™ RP94389

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55833 (PA5-55833. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DnaJ heat shock induced proteins are from the bacterium Escherichia coli and are under the control of the htpR regulatory protein. The DnaJ proteins play a critical role in the HSP 70 chaperone machine by interacting with HSP 70 to stimulate ATP hydrolysis. The proteins contain cysteine rich regions that are composed of zinc fingers that form a peptide binding domain responsible for the chaperone function. DnaJ proteins are important mediators of proteolysis and are involved in the regulation of protein degradation, exocytosis and endocytosis. DnaJB4 (DnaJ homolog subfamily B member 4), also known as HLJ1, is expressed in skeletal muscle, heart and pancreas, and lower expression in brain, placenta and liver.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9UDY4
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 11080
Nombre Human DNAJB4 (aa 274-337) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1700029A20Rik; 2010306G19Rik; 5730460G06Rik; DjB4; DnaJ (Hsp40) homolog, subfamily B, member 4; DnaJ (Hsp40) homolog, subfamily B, member 4-like; DnaJ heat shock protein family (Hsp40) member B4; dnaJ homolog subfamily B member 4; DNAJB 4; Dnajb4; DnaJ-like heat shock protein 40; DNAJW; Heat shock 40 kDa protein 1 homolog; heat shock protein 40 homolog; HLJ 1; HLJ1; HSP40 homolog; human liver DnaJ-like protein
Nombre común DNAJB4
Símbolo de gen Dnajb4
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia GRNIPMSVNDIVKPGMRRRIIGYGLPFPKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHLPAS
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado