missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DGKI Control Fragment Recombinant Protein

Código de producto. 30212262
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30212262 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30212262

Marca: Invitrogen™ RP92769

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54539 (PA5-54539. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Diacylglycerol (DAG) influences numerous cell signaling cascades by functioning as an intracellular, allosteric activator of protein kinase C (PKC), and as a potent activator of guanine nucleotide exchange factors. In order to maintain cellular homeostasis, intracellular DAG levels are tightly regulated by diacylglycerol kinases (DGKs, DAGKs), which phosphorylate DAG to phosphatidic acid, thus removing DAG. Human DGK-α (80 kDa), -β (90 kDa), and - γ (90 kDa) have calcium-binding EF-hand motifs at their N termini and are classified as type I DGKs. Human DGK-δ (130 kDa) and DGK-ι (130 kDa) contain N-terminal pleckstrin homology (PH) domains and are classified as type II. Human DGK-epsilon (64 kDa) contains no identifiable regulatory domains and is classified as a type III DGK. Human DGK-Ω (104 kDa) and -iota (130 kDa) possess C-terminal ankyrin repeats and are classified as type IV DGKs. Human DGK-θ (110 kDa) contains 3 cysteine-rich domains and a PH domain and is classified as a type V DGK.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso O75912
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 9162
Nombre Human DGKI Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen C130010K08Rik; DAG kinase iota; DGKI; DGK-iota; Diacylglycerol kinase iota; diacylglycerol kinase iota-3; diacylglycerol kinase, iota; Diglyceride kinase; diglyceride kinase iota; EC 2.7.1.107; rDGKi-3
Nombre común DGKI
Símbolo de gen DGKI
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia IRVNKISLQDYEGFHYDKEKLREASIPLGILVVRGDCDLETCRMYIDRLQEDLQSVSSGSQRVHYQDHET
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.