missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30197280

Invitrogen™ Human DDI1 (aa 362-394) Control Fragment Recombinant Protein

Código de producto. 30197280
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30197280 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30197280

Marca: Invitrogen™ RP101466

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140306 (PA5-140306. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ddi1 (DNA-damage inducible 1)appears to release substrate from an ubiquitination complex, making the substrate available for deubiquitination to facilitate proteasomal degradation. Ddi1 could be a potential selective target for lung cancer treatment. Ddi1 runs as a doublet of 54/56 kDa on acrylamide gels besides the calculated MW 44 kDa.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q8WTU0
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 414301
Nombre Human DDI1 (aa 362-394) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1700011N24Rik; DDI1; DDI1, DNA-damage inducible 1, homolog 1; DDI1, DNA-damage inducible 1, homolog 1 (S. cerevisiae); DNA damage inducible 1 homolog 1; DNA-damage inducible 1 homolog 1; DNA-damage inducible 1 homolog 1 (S. cerevisiae); DNA-damage inducible protein 1; protein DDI1 homolog 1; RGD1559430
Nombre común DDI1
Símbolo de gen DDI1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia PEGELPLCSRMVSGQDESSDKEITHSVMDSGRK
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.