missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DDB1 (aa 541-651) Control Fragment Recombinant Protein

Código de producto. 30203448
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
30203448 100 μL 100 microlitros
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 30203448 Proveedor Invitrogen™ N.º de proveedor RP107637

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The DNA damage-binding protein from HeLa cells is associated with polypeptides of relative mass 124,000 (DDB1) and 41,000 (DDB2) as determined by SDS-polyacrylamide gels. To test whether the DNA-repair defect in the subset of XPE patients that lack DNA damage-binding activity is caused by a defect in DDB, Keeney et al. (1994) injected purified human DDB protein into XPE cells.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q16531
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 1642
Nombre Human DDB1 (aa 541-651) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 127 kDa; AA408517; damage specific DNA binding protein 1; damaged-DNA recognition protein 1; damage-specific DNA binding protein 1, 127 kDa; damage-specific DNA-binding protein 1; damage-specific DNA-binding protein, DNA repair; DDB p127 subunit; DDB1; DDBa; DNA damage-binding protein 1; DNA damage-binding protein a; DNA repair protein; HBV X-associated protein 1; p127-Ddb1; UV-damaged DNA-binding factor; UV-damaged DNA-binding protein 1; UV-DDB 1; UV-DDB1; XAP1; XAP-1; xeroderma pigmento; Xeroderma pigmentosum group E-complementing protein; XPCE; XPE; XPE-BF; XPE-binding factor
Nombre común DDB1
Símbolo de gen DDB1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFA
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.