missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DAZAP1 (aa 20-154) Control Fragment Recombinant Protein

Código de producto. 30194879
Change view
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Código de producto. Cantidad unitSize
30194879 100 μL 100 microlitros
1 options
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30194879

Marca: Invitrogen™ RP102467

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52083 (PA5-52083. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The androgen receptor (AR) is a member of the steroid-hormone receptor superfamily of nuclear receptors. The receptor is more than 90 kDa and has three major functional domains: the N-terminal domain, DNA-binding domain, and the androgen-binding domain. The androgen receptor is a ligand-activated transcription factor that binds active testosterone (T) and dihydrotestosterone (DHT). Upon binding the hormone ligand, the receptor dissociates from accessory proteins, translocates into the nucleus, dimerizes, and then stimulates transcription of androgen responsive genes. The AR signaling pathway plays a key role in development and function of male reproductive organs, including the prostate and epididymis.AR also plays a role in nonreproductive organs, such as muscle, hair follicles, and brain.Androgen Receptor is a phosphoprotein, and also regulates mitogen-activated protein kinase (MAP kinase). The inhibition of the MEK1/2 pathway correlates directly with a change in phosphorylation state of the androgen receptor. Abnormalities in the AR signaling pathway have been linked to a number of diseases, including prostate cancer, Kennedy's disease, and male infertility. Mutations in this gene are associated with complete androgen insensitivity (CAIS).
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q96EP5
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 26528
Nombre Human DAZAP1 (aa 20-154) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 2410042M16Rik; DAZ associated protein 1; DAZAP1; DAZ-associated protein 1; Deleted in azoospermia-associated protein 1; LOC561459 protein; LOW QUALITY PROTEIN: DAZ-associated protein 1; MGC19907; mPrrp; testicular tissue protein Li 50
Nombre común DAZAP1
Símbolo de gen DAZAP1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia STTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPR
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.