Learn More
Invitrogen™ Human Cyclin A2 (aa 79-144) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP92872
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82732 (PA5-82732. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Cyclins are regulatory subunits of the cyclin-dependent kinases (cdks) and they control transition at different specific phases of the cell cycle. The temporal expression of cyclins is tightly regulated and subsequently plays a critical role in controlling the enzymatic activity of cdks. These cyclin / cdk complexes are essential for passage through specific stages in the cell cycle. In mammalian somatic cells, cyclin A is required for S phase and passage through G2-phase.
Especificaciones
P20248 | |
Blocking Assay, Control | |
890 | |
100 μL | |
AA408589; Ccn1; Ccn-1; CCNA; CCNA2; ccna2.S; Cyca; CycA2; Cyclin A; cyclin A2; Cyclin A2 (Cyclin A); cyclin A2 S homeolog; Cyclin A-3; cyclin-A; Cyclin-A2; XELAEV_18009326mg | |
CCNA2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Cyclin A2 (aa 79-144) Control Fragment | |
RUO | |
Cyclin A2 | |
Unconjugated | |
Recombinant | |
PVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKPLVPL | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.